Speedy protein C (SPDYC) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SPDYC Antibody is: synthetic peptide directed towards the N-terminal region of Human SPDYC. Synthetic peptide located within the following region: PISISYEMSDSQDPTTSPVVTTQVELGGCSRQGGGNGFLRFRQHQEVQAF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	33 kDa
Gene Name	speedy/RINGO cell cycle regulator family member C
Database Link	NP_001008778 Entrez Gene 387778 Human UniProt ID Q5MJ68
Background	SPDYC promotes progression through the cell cycle via binding and activation of CDK1 and CDK2. It is involved in the spindle-assembly checkpoint. It is required for recruitment of MAD2L1, BUBR1 and BUB1 to kinetochores and is required for the correct localization of the active form of Aurora B in prometaphase.
Synonyms	Ringo2; RINGOC
Note	Immunogen sequence homology: Human: 100%
Reference Data
Protein Pathways	Oocyte meiosis, Progesterone-mediated oocyte maturation

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.