Lmtk3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Lmtk3 Antibody is: synthetic peptide directed towards the middle region of Mouse Lmtk3. Synthetic peptide located within the following region: RGLLKSPRAADEPEDSELERKRKMVSFHGDVTVYLFDQETPTNELSVQGT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	151 kDa
Gene Name	lemur tyrosine kinase 3
Database Link	NP_001005511 Entrez Gene 381983 Mouse UniProt ID Q5XJV6
Background	The function of this protein remains unknown.
Synonyms	KIAA1883; LMR3; TYKLM3
Note	Immunogen sequence homology: Pig: 100%; Human: 100%; Bovine: 100%; Mouse: 93%; Guinea pig: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.