C10orf90 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-C10orf90 Antibody is: synthetic peptide directed towards the C-terminal region of Human C10orf90. Synthetic peptide located within the following region: QDVCASLQEDNGVQIESKFPKGDYTCCDLVVKIKECKKSEDPTTPEPSPA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	77 kDa
Gene Name	chromosome 10 open reading frame 90
Database Link	NP_001004298 Entrez Gene 118611 Human UniProt ID Q96M02
Background	C10orf90 is a tumor suppressor that is required to sustain G2/M checkpoint after DNA damage. It mediates CDKN1A/p21 protein stability in a ubiquitin-independent manner. It may have a role in the assembly of primary cilia.
Synonyms	bA422P15.2; FATS
Note	Immunogen sequence homology: Human: 100%; Rat: 86%; Pig: 85%; Guinea pig: 85%; Mouse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.