IDNK Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-IDNK Antibody is: synthetic peptide directed towards the N-terminal region of Human IDNK. Synthetic peptide located within the following region: LLASELGWKFYDADDYHPEENRRKMGKGIPLNDQDRIPWLCNLHDILLRD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	16 kDa
Gene Name	idnK, gluconokinase homolog (E. coli)
Database Link	NP_001001551 Entrez Gene 414328 Human UniProt ID Q5T6J7
Background	The function of this protein remains unknown.
Synonyms	bA522I20.2; C9orf103; hGntK
Note	Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%; Horse: 79%; Mouse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.