MRP2 (ABCC2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Abcc2 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TIQDVNLDIKPGQLVAVVGTVGSGKSSLISAMLGEMENVHGHITIKGSIA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	174 kDa
Gene Name	ATP binding cassette subfamily C member 2
Database Link	NP_000383 Entrez Gene 12780 Mouse UniProt ID Q92887
Background	Abcc2 mediates hepatobiliary excretion of numerous organic anions. Abcc2 may function as a cellular cisplatin transporter.
Synonyms	ABC30; CMOAT; cMRP; DJS; MRP2
Note	Immunogen sequence homology: Rat: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Guinea pig: 93%; Dog: 86%; Mouse: 86%; Bovine: 79%
Reference Data
Protein Families	Druggable Genome, Transmembrane
Protein Pathways	ABC transporters

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.