PLPP6 Rabbit Polyclonal Antibody
CAT#: TA333316
Rabbit Polyclonal Anti-PPAPDC2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-PPAPDC2 Antibody: synthetic peptide directed towards the N terminal of human PPAPDC2. Synthetic peptide located within the following region: MPSPRRSMEGRPLGVSASSSSSSPGSPAHGGGGGGSRFEFQSLLSSRATA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 32 kDa |
Gene Name | phospholipid phosphatase 6 |
Database Link | |
Background | PPAPDC2 is the phosphatase that dephosphorylates presqualene diphosphate (PSDP) into presqualene monophosphate (PSMP), suggesting that it may be indirectly involved in innate immunity. PSDP is a bioactive lipid that rapidly remodels to presqualene monophosphate PSMP upon cell activation. PPAPDC2 displays diphosphate phosphatase activity with a substrate preference for PSDP > FDP > phosphatidic acid. |
Synonyms | bA6J24.6; PDP1; PPAPDC2; PSDP |
Note | Immunogen sequence homology: Human: 100%; Bovine: 100%; Rabbit: 93%; Rat: 87%; Dog: 86%; Pig: 81%; Mouse: 79% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |