RIPK5 (DSTYK) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-DSTYK Antibody: synthetic peptide directed towards the middle region of human RIPK5. Synthetic peptide located within the following region: EECWQLMEACWDGDPLKRPLLGIVQPMLQGIMNRLCKSNSEQPNRGLDDS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	100 kDa
Gene Name	dual serine/threonine and tyrosine protein kinase
Database Link	NP_955749 Entrez Gene 25778 Human UniProt ID Q6XUX3
Background	RIPK5 may induce both caspase-dependent apoptosis and caspase-independent cell death.This gene encodes a dual serine/threonine and tyrosine protein kinase which is expressed in multiple tissues. Multiple alternatively spliced transcript variants have been found, but the biological validity of some variants has not been determined.
Synonyms	CAKUT1; DustyPK; HDCMD38P; RIP5; RIPK5
Note	Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%; Rat: 90%; Mouse: 86%; Bovine: 86%; Rabbit: 85%
Reference Data
Protein Families	Druggable Genome, Protein Kinase

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.