CCDC172 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-C10orf96 Antibody: synthetic peptide directed towards the middle region of human C10orf96. Synthetic peptide located within the following region: QANMLKSEMKSMEHDSSQLNELQKQKSELIQELFTLQRKLKVFEDEENES
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	31 kDa
Gene Name	coiled-coil domain containing 172
Database Link	NP_940917 Entrez Gene 374355 Human UniProt ID P0C7W6
Background	The specific function of this protein remains unknown.
Synonyms	C10orf96
Note	Immunogen sequence homology: Human: 100%; Pig: 93%; Dog: 86%; Rabbit: 86%; Guinea pig: 86%; Horse: 85%; Yeast: 85%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.