Eras Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Eras Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LPTKSSILDLSSGTPCTRSPEESHEAWAQCKDAGRQLPEYKAVVVGASGV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	ES cell-expressed Ras
Database Link	NP_853526 Entrez Gene 353283 Mouse UniProt ID Q7TN89
Background	Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Eras plays an important role in the tumor-like growth properties of embryonic stem cells.
Synonyms	E-Ras; HRAS2; HRASP; MGC126691; MGC126693
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.