ANGPTL5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ANGPTL5 Antibody: synthetic peptide directed towards the N terminal of human ANGPTL5. Synthetic peptide located within the following region: ASLDYLSNQVNELMNRVLLLTTEVFRKQLDPFPHRPVQSHGLDCTDIKDT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	44 kDa
Gene Name	angiopoietin like 5
Database Link	NP_835228 Entrez Gene 253935 Human UniProt ID Q86XS5
Background	The exact functions of ANGPTL5 remain unknown.
Synonyms	angiopoietin-like 5; fibrinogen-like
Note	Immunogen sequence homology: Horse: 100%; Human: 100%; Pig: 93%; Bovine: 93%; Dog: 86%; Guinea pig: 86%
Reference Data
Protein Families	Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.