KRT84 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-KRT84 Antibody: synthetic peptide directed towards the middle region of human KRT84. Synthetic peptide located within the following region: ESYITNLRRQLEVLVSDQARLQAERNHLQDVLEGFKKKYEEEVVCRANAE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	65 kDa
Gene Name	keratin 84
Database Link	NP_149034 Entrez Gene 3890 Human UniProt ID Q9NSB2
Background	The protein encoded by this gene is a member of the keratin gene family. As a type II hair keratin, it is a basic protein which heterodimerizes with type I keratins to form hair and nails. The type II hair keratins are clustered in a region of chromosome 12q13 and are grouped into two distinct subfamilies based on structure similarity. One subfamily, consisting of KRTHB1, KRTHB3, and KRTHB6, is highly related. The other less-related subfamily includes KRTHB2, KRTHB4, and KRTHB5. All hair keratins are expressed in the hair follicle; this hair keratin is contained primarily in the filiform tongue papilla, among other hair keratins. [provided by RefSeq, Jul 2008]
Synonyms	HB4; KRTHB4
Note	Immunogen sequence homology: Human: 100%; Mouse: 100%; Rat: 93%; Rabbit: 93%; Bovine: 86%; Horse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.