Traf3ip1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Traf3ip1 Antibody is: synthetic peptide directed towards the N-terminal region of Mouse Traf3ip1. Synthetic peptide located within the following region: VIRITGFMKGLYTDAEMKSENVKDKDAKISFLQKAIDVVMMVSGEPLAAK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	69 kDa
Gene Name	TRAF3 interacting protein 1
Database Link	NP_082994 Entrez Gene 74019 Mouse UniProt ID Q149C2
Background	Traf3ip1 play an inhibitory role on IL13 signaling by binding to IL13RA1. It is involved in suppression of IL13-induced STAT6 phosphorylation, transcriptional activity and DNA-binding. It recruits TRAF3 and DISC1 to the microtubules.
Synonyms	DKFZp434F124; MIP-T3; MIPT3
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.