ACTR8 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ACTR8 Antibody is: synthetic peptide directed towards the N-terminal region of Human ACTR8. Synthetic peptide located within the following region: MTQAEKGDTENGKEKGGEKEKEQRGVKRPIVPALVPESLQEQIQSNFIIV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	70 kDa
Gene Name	ARP8 actin-related protein 8 homolog
Database Link	NP_075050 Entrez Gene 93973 Human UniProt ID Q9H981
Background	ACTR8 plays an important role in the functional organization of mitotic chromosomes.
Synonyms	ARP8; hArp8; INO80N
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.