PGRP1B (PGLYRP4) Rabbit Polyclonal Antibody
CAT#: TA333739
Rabbit Polyclonal Anti-PGLYRP4 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-PGLYRP4 Antibody is: synthetic peptide directed towards the N-terminal region of Human PGLYRP4. Synthetic peptide located within the following region: LGIQAWGDSSWNKTQAKQVSEGLQYLFENISQLTEKGLPTDVSTTVSRKA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 39 kDa |
Gene Name | peptidoglycan recognition protein 4 |
Database Link | |
Background | Peptidoglycan recognition proteins, such as PGRPI-beta, are part of the innate immune system and recognize peptidoglycan, a ubiquitous component of bacterial cell walls. |
Synonyms | PGLYRPIbeta; PGRP-Ibeta; PGRPIB; SBBI67 |
Note | Immunogen sequence homology: Human: 100%; Rat: 75% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |