SLC39A9 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC39A9 Antibody: synthetic peptide directed towards the middle region of human SLC39A9. Synthetic peptide located within the following region: YIGVSLVLGFVFMLLVDQIGNSHVHSTDDPEAARSSNSKITTTLGLVVHA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	solute carrier family 39 member 9
Database Link	NP_060845 Entrez Gene 55334 Human UniProt ID Q9NUM3
Background	SLC39A9 may act as a zinc-influx transporter.
Synonyms	ZIP-9; ZIP9
Note	Immunogen sequence homology: Human: 100%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%; Rat: 83%; Rabbit: 79%; Guinea pig: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.