EPN3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-EPN3 Antibody is: synthetic peptide directed towards the C-terminal region of Human EPN3. Synthetic peptide located within the following region: ESTETKEGLEQALPSGKPSSPVELDLFGDPSPSSKQNGTKEPDALDLGIL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	70 kDa
Gene Name	epsin 3
Database Link	NP_060427 Entrez Gene 55040 Human UniProt ID Q9H201
Background	The function of this protein remains unknown.
Synonyms	FLJ20778; MGC129899
Note	Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Rat: 86%; Mouse: 79%; Bovine: 79%
Reference Data
Protein Pathways	Endocytosis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.