SLC43A3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC43A3 Antibody: synthetic peptide directed towards the N terminal of human SLC43A3. Synthetic peptide located within the following region: MAGQGLPLHVATLLTGLLECLGFAGVLFGWPSLVFVFKNEDYFKDLCGPD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	54 kDa
Gene Name	solute carrier family 43 member 3
Database Link	NP_060081 Entrez Gene 29015 Human UniProt ID Q8NBI5
Background	SLC43A3 belongs to the SLC43A transporter family and is a putative transporter.
Synonyms	EEG1; FOAP-13; PRO1659; SEEEG-1
Note	Immunogen sequence homology: Human: 100%; Dog: 92%; Rabbit: 92%; Horse: 86%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.