Syntenin 2 (SDCBP2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SDCBP2 Antibody: synthetic peptide directed towards the N terminal of human SDCBP2. Synthetic peptide located within the following region: VAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	23 kDa
Gene Name	syndecan binding protein 2
Database Link	NP_056500 Entrez Gene 27111 Human UniProt ID Q9H190
Background	SDCBP2 contains 2 PDZ (DHR) domains. The function of SDCBP2 remains unknown.
Synonyms	SITAC; SITAC18; ST-2
Note	Immunogen sequence homology: Rat: 100%; Human: 100%; Rabbit: 100%; Dog: 92%; Pig: 92%; Horse: 92%; Guinea pig: 92%; Bovine: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.