WHSC1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-WHSC1 Antibody: synthetic peptide directed towards the N terminal of human WHSC1. Synthetic peptide located within the following region: KYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	88 kDa
Gene Name	Wolf-Hirschhorn syndrome candidate 1
Database Link	NP_055734 Entrez Gene 7468 Human UniProt ID O96028
Background	WHSC1 encodes a protein that contains four domains present in other developmental proteins: a PWWP domain, an HMG box, a SET domain, and a PHD-type zinc finger. It is expressed ubiquitously in early development. Wolf-Hirschhorn syndrome (WHS) is a malformation syndrome associated with a hemizygous deletion of the distal short arm of chromosome 4.
Synonyms	FLJ23286; KIAA1090; MMSET; NSD2; REIIBP; TRX5
Note	Immunogen sequence homology: Horse: 100%; Human: 100%; Dog: 93%; Pig: 88%; Guinea pig: 88%; Rat: 86%; Mouse: 86%; Rabbit: 76%
Reference Data
Protein Families	Druggable Genome, Transcription Factors
Protein Pathways	Lysine degradation

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.