xCT (SLC7A11) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC7A11 Antibody: synthetic peptide directed towards the middle region of human SLC7A11. Synthetic peptide located within the following region: KGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	55 kDa
Gene Name	solute carrier family 7 member 11
Database Link	NP_055146 Entrez Gene 23657 Human UniProt ID Q9UPY5
Background	SLC7A11 is a member of a heteromeric Na(+)-independent anionic amino acid transport system highly specific for cystine and glutamate. In this system, designated system Xc(-), the anionic form of cystine is transported in exchange for glutamate.
Synonyms	CCBR1; xCT
Note	Immunogen sequence homology: Human: 100%; Dog: 92%; Pig: 92%; Horse: 92%; Sheep: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92%; Rat: 85%; Mouse: 85%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.