BTG2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-BTG2 Antibody: synthetic peptide directed towards the middle region of human BTG2. Synthetic peptide located within the following region: HKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	17 kDa
Gene Name	BTG family member 2
Database Link	NP_006754 Entrez Gene 7832 Human UniProt ID P78543
Background	BTG2 is an anti-proliferative protein. BTG2 modulates transcription regulation mediated by ESR1.
Synonyms	APRO1; PC3; TIS21
Note	Immunogen sequence homology: Rat: 100%; Human: 100%; Dog: 92%; Pig: 92%; Mouse: 92%; Sheep: 92%; Bovine: 92%; Guinea pig: 92%; Horse: 85%; Rabbit: 85%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.