SLC9A3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC9A3 Antibody: synthetic peptide directed towards the middle region of human SLC9A3. Synthetic peptide located within the following region: AEDMVTHHTLQQYLYKPRQEYKHLYSRHELTPTEDEKQDREIFHRTMRKR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	93 kDa
Gene Name	solute carrier family 9 member A3
Database Link	NP_004165 Entrez Gene 6550 Human UniProt ID P48764
Background	SLC9A3 is involved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. SLC9A3 is the major proton extruding system driven by the inward sodium ion chemical gradient. SLC9A3 plays an important role in signal transduction.
Synonyms	NHE3
Note	Immunogen sequence homology: Human: 100%; Dog: 92%; Rat: 92%; Mouse: 92%; Pig: 77%; Sheep: 77%; Bovine: 77%; Rabbit: 77%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.