ZFP37 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZFP37 Antibody: synthetic peptide directed towards the middle region of human ZFP37. Synthetic peptide located within the following region: LCCHSSSHIKQDKIQTGEKHEKSPSLSSSTKHEKPQACVKPYECNQCGKV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	71 kDa
Gene Name	ZFP37 zinc finger protein
Database Link	NP_003399 Entrez Gene 7539 Human UniProt ID Q9Y6Q3
Background	ZFP37 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 12 C2H2-type zinc fingers and 1 KRAB domain. ZFP37 may be involved in transcriptional regulation.
Synonyms	zfp-37; ZNF906
Note	Immunogen sequence homology: Dog: 100%; Human: 100%; Bovine: 92%; Pig: 86%; Rat: 79%; Mouse: 79%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.