TFAP4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TFAP4 Antibody: synthetic peptide directed towards the C terminal of human TFAP4. Synthetic peptide located within the following region: EEEQRRAVIVKPVRSCPEAPTSDTASDSEASDSDAMDQSREEPSGDGELP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	transcription factor AP-4 (activating enhancer binding protein 4)
Database Link	NP_003214 Entrez Gene 7023 Human UniProt ID Q01664
Background	Enhancer binding protein TFAP4 is a transcription factor that activates both viral and cellular genes by binding to the symmetrical DNA sequence, CAGCTG.
Synonyms	AP-4; bHLHc41
Note	Immunogen sequence homology: Human: 100%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.