TFAP4 Rabbit Polyclonal Antibody

CAT#: TA334018

Rabbit Polyclonal Anti-TFAP4 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of transcription factor AP-4 (activating enhancer binding protein 4) (TFAP4)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human transcription factor AP-4 (activating enhancer binding protein 4) (TFAP4), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human transcription factor AP-4 (activating enhancer binding protein 4) (TFAP4), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-TFAP4 Antibody: synthetic peptide directed towards the C terminal of human TFAP4. Synthetic peptide located within the following region: EEEQRRAVIVKPVRSCPEAPTSDTASDSEASDSDAMDQSREEPSGDGELP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 39 kDa
Gene Name transcription factor AP-4 (activating enhancer binding protein 4)
Background Enhancer binding protein TFAP4 is a transcription factor that activates both viral and cellular genes by binding to the symmetrical DNA sequence, CAGCTG.
Synonyms AP-4; bHLHc41
Note Immunogen sequence homology: Human: 100%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%
Reference Data
Protein Families Druggable Genome, Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...