TFIISH (TCEA3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TCEA3 Antibody: synthetic peptide directed towards the middle region of human TCEA3. Synthetic peptide located within the following region: KSTDMKYRNRVRSRISNLKDPRNPGLRRNVLSGAISAGLIAKMTAEEMAS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	transcription elongation factor A3
Database Link	NP_003187 Entrez Gene 6920 Human UniProt ID O75764
Background	Polyclonal antibody produced in rabbits immunized with a synthetic peptide corresponding to a region of Human TCEA3 with an internal ID of P04456
Synonyms	TFIIS; TFIIS.H
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 92%; Guinea pig: 92%; Mouse: 85%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.