SYCE2 Rabbit Polyclonal Antibody
CAT#: TA334098
Rabbit Polyclonal Anti-SYCE2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SYCE2 Antibody is: synthetic peptide directed towards the C-terminal region of Human SYCE2. Synthetic peptide located within the following region: LKQVCHSVETVYKDLCLQPEQSLRLRWGPDHSRGKSPPRPGNSQPPDVFV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 23 kDa |
Gene Name | synaptonemal complex central element protein 2 |
Database Link | |
Background | SYCE2 is a major component of the transverse central element of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. SYCE2 requires SYCP1 in order to be incorporated into the central element and may have a role in the synaptonemal complex assembly, stabilization and recombination. |
Synonyms | CESC1 |
Note | Immunogen sequence homology: Human: 100% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |