MEX3A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-MEX3A Antibody is: synthetic peptide directed towards the N-terminal region of Human MEX3A. Synthetic peptide located within the following region: GEEPVFMVTGRREDVATARREIISAAEHFSMIRASRNKSGAAFGVAPALP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	54 kDa
Gene Name	mex-3 RNA binding family member A
Database Link	NP_001087194 Entrez Gene 92312 Human UniProt ID A1L020
Background	MEX3A is a RNA binding protein, may be involved in post-transcriptional regulatory mechanisms.
Synonyms	MEX-3A; RKHD4
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.