Dopamine Transporter (SLC6A3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC6A3 Antibody: synthetic peptide directed towards the N terminal of human SLC6A3. Synthetic peptide located within the following region: HCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	68 kDa
Gene Name	solute carrier family 6 member 3
Database Link	NP_001035 Entrez Gene 6531 Human UniProt ID Q01959
Background	This gene encodes a dopamine transporter which is a member of the sodium- and chloride-dependent neurotransmitter transporter family. The 3' UTR of this gene contains a 40 bp tandem repeat, referred to as a variable number tandem repeat or VNTR, which can be present in 3 to 11 copies. Variation in the number of repeats is associated with idiopathic epilepsy, attention-deficit hyperactivity disorder, dependence on alcohol and cocaine, susceptibility to Parkinson disease and protection against nicotine dependence.
Synonyms	DAT; DAT1; PKDYS
Note	Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%; Zebrafish: 79%
Reference Data
Protein Families	Druggable Genome, Transmembrane
Protein Pathways	Parkinson's disease

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.