SLC5A9 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC5A9 Antibody: synthetic peptide directed towards the N terminal of human SLC5A9. Synthetic peptide located within the following region: MSKELAAMGPGASGDGVRTETAPHIALDSRVGLHAYDISVVVIYFVFVIA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	76 kDa
Gene Name	solute carrier family 5 member 9
Database Link	NP_001011547 Entrez Gene 200010 Human UniProt ID Q2M3M2
Background	SLC5A9 is involved in sodium-dependent transport of D-mannose, D-glucose and D-fructose.
Synonyms	SGLT4
Note	Immunogen sequence homology: Human: 100%; Horse: 86%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.