ZBTB39 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZBTB39 antibody: synthetic peptide directed towards the middle region of human ZBTB39. Synthetic peptide located within the following region: CRLCSQSFKSEAAYRYHVSQHKCNSGLDARPGFGLQHPALQKRKLPAEEF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	79 kDa
Gene Name	zinc finger and BTB domain containing 39
Database Link	NP_055645 Entrez Gene 9880 Human UniProt ID O15060
Background	ZBTB39 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 1 BTB (POZ) domain and 8 C2H2-type zinc fingers. ZBTB39 may be involved in transcriptional regulation.
Synonyms	ZNF922
Note	Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Rat: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.