Asialoglycoprotein Receptor 1 (ASGR1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ASGR1 antibody: synthetic peptide directed towards the N terminal of human ASGR1. Synthetic peptide located within the following region: RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	33 kDa
Gene Name	asialoglycoprotein receptor 1
Database Link	NP_001662 Entrez Gene 432 Human UniProt ID P07306
Background	ASGR1 encodes for a cell surface receptor binds to galactose-terminated glycoproteins. It transports these glycoproteins via a series of membrane vesicles and tubules to an acidic-sorting organelle where the receptor and ligand dissociates. Then the receptor is recycled back to the cell surface.
Synonyms	ASGPR; ASGPR1; CLEC4H1; HL-1
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 92%; Guinea pig: 92%; Mouse: 91%; Horse: 86%; Bovine: 85%; Yeast: 75%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.