G protein regulated inducer of neurite outgrowth 2 (GPRIN2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GPRIN2 antibody is: synthetic peptide directed towards the N-terminal region of Human GPRIN2. Synthetic peptide located within the following region: LSQSSSSLLGEGREQRPELRKTASSTVWQAQLGEASTRPQAPEEEGNPPE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	51 kDa
Gene Name	G protein regulated inducer of neurite outgrowth 2
Database Link	NP_055511 Entrez Gene 9721 Human UniProt ID O60269
Background	GPRIN2 may be involved in neurite outgrowth.
Synonyms	GRIN2; KIAA0514
Note	Immunogen Sequence Homology: Human: 100%; Yeast: 100%; Pig: 93%; Guinea pig: 93%; Rat: 92%
Reference Data
Protein Families	Stem cell - Pluripotency

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.