NAD Synthetase (NADSYN1) Rabbit Polyclonal Antibody

CAT#: TA334335

Rabbit Polyclonal Anti-NADSYN1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,200.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of NAD synthetase 1 (NADSYN1)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human NAD synthetase 1 (NADSYN1), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human NAD synthetase 1 (NADSYN1), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-NADSYN1 antibody is: synthetic peptide directed towards the C-terminal region of Human NADSYN1. Synthetic peptide located within the following region: NQISYTPQDPRDLCGRILTTCYMASKNSSQETCTRARELAQQIGSHHISL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 78 kDa
Gene Name NAD synthetase 1
Background Nicotinamide adenine dinucleotide (NAD) is a coenzyme in metabolic redox reactions, a precursor for several cell signaling molecules, and a substrate for protein posttranslational modifications. NAD synthetase (EC 6.3.5.1) catalyzes the final step in the biosynthesis of NAD from nicotinic acid adenine dinucleotide (NaAD).
Synonyms FLJ10631; FLJ36703; FLJ40627
Note Immunogen Sequence Homology: Human: 100%; Bovine: 86%; Dog: 85%; Pig: 85%; Rat: 85%; Guinea pig: 85%
Reference Data
Protein Pathways Metabolic pathways, Nicotinate and nicotinamide metabolism
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...