QSOX2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-QSOX2 antibody is: synthetic peptide directed towards the middle region of Human QSOX2. Synthetic peptide located within the following region: VVKPLRAFFSSYLKSLPDVRKKSLPLPEKPHKEENSEIVVWREFDKSKLY
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	77 kDa
Gene Name	quiescin sulfhydryl oxidase 2
Database Link	NP_859052 Entrez Gene 169714 Human UniProt ID Q6ZRP7
Background	QSOX2 is a member of the sulfhydryl oxidase/quiescin-6 (Q6) family that regulates the sensitization of neuroblastoma cells for IFN-gamma-induced cell death.
Synonyms	QSCN6L1; SOXN
Note	Immunogen Sequence Homology: Human: 100%; Pig: 85%; Rat: 85%; Horse: 85%; Guinea pig: 85%; Dog: 77%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.