Cplane2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-6330545A04Rik antibody is: synthetic peptide directed towards the N-terminal region of Mouse 6330545A04Rik. Synthetic peptide located within the following region: NRRREFGLLERPVLPPSVVIDTASYKIFVSGKSGVGKTALVAKLAGLEVP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	28 kDa
Gene Name	REM2 and RAB-like small GTPase 1
Database Link	NP_001074643 Entrez Gene 76166 Mouse UniProt ID A2A825
Background	6330545A04Rik has a potential effector of the planar cell polarity signaling pathway. It plays a role in targeted membrane trafficking most probably at the level of vesicle fusion with membranes. It is involved in cilium biogenesis by regulating the transport of cargo proteins to the basal body and to the apical tips of cilia and is more generally involved in exocytosis in secretory cells.
Synonyms	C1orf89; RP4-733M16.4
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Rabbit: 93%; Guinea pig: 93%; Yeast: 83%; Zebrafish: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.