SLFN5 Rabbit Polyclonal Antibody
CAT#: TA334381
Rabbit Polyclonal Anti-SLFN5 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SLFN5 antibody is: synthetic peptide directed towards the N-terminal region of Human SLFN5. Synthetic peptide located within the following region: VDAGKVTLGTQQRQEMDPRLREKQNEIILRAVCALLNSGGGIIKAEIENK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 98 kDa |
Gene Name | schlafen family member 5 |
Database Link | |
Background | SLFN5 may have a role in hematopoietic cell differentiation. |
Synonyms | MGC19764; MGC150611; MGC150612 |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |