PTPN22 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PTPN22 antibody is: synthetic peptide directed towards the middle region of Human PTPN22. Synthetic peptide located within the following region: TAPRIDDEIPPPLPVWTPESFIVVEEAGEFSPNVPKSLSSAVKVKIGTSL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	61 kDa
Gene Name	protein tyrosine phosphatase, non-receptor type 22
Database Link	NP_001180360 Entrez Gene 26191 Human UniProt ID Q9Y2R2
Background	The function of this protein remains unknown.
Synonyms	LYP; LYP1; LYP2; PEP; PTPN8
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 93%; Dog: 86%; Yeast: 82%; Rabbit: 79%; Zebrafish: 79%
Reference Data
Protein Families	Druggable Genome, Phosphatase

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.