IFIT5 Rabbit Polyclonal Antibody
CAT#: TA334459
Rabbit Polyclonal Anti-IFIT5 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
Cited in 1 publication. |
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-IFIT5 antibody: synthetic peptide directed towards the middle region of human IFIT5. Synthetic peptide located within the following region: ITVYRLDDSDREGSVKSFSLGPLRKAVTLNPDNSYIKVFLALKLQDVHAE |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 56 kDa |
Gene Name | interferon induced protein with tetratricopeptide repeats 5 |
Database Link | |
Background | IFIT5 belongs to the IFIT family. It contains 8 TPR repeats. The exact function of IFIT5 remains unknown. |
Synonyms | ISG58; P58; RI58 |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Horse: 79% |
Reference Data |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Quantitative Proteomic Analysis of Duck Ovarian Follicles Infected with Duck Tembusu Virus by Label-Free LC-MS
,Han, K;Zhao, D;Liu, Y;Liu, Q;Huang, X;Yang, J;An, F;Li, Y;,
Front Microbiol
,PubMed ID 27066001
[IFIT5]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |