Isoleucyl tRNA synthetase (IARS) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-IARS antibody: synthetic peptide directed towards the middle region of human IARS. Synthetic peptide located within the following region: YEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTAD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	144 kDa
Gene Name	isoleucyl-tRNA synthetase
Database Link	NP_038203 Entrez Gene 3376 Human UniProt ID P41252
Background	Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAS, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Isoleucine-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family and has been identified as a target of autoantibodies in the autoimmune disease polymyositis/dermatomyositis. Two alternatively spliced variants have been isolated that represent alternate 5' UTRs.
Synonyms	IARS1; ILERS; ILRS; IRS; PRO0785
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Guinea pig: 93%; Rabbit: 92%; Dog: 85%; Horse: 85%; Bovine: 85%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Aminoacyl-tRNA biosynthesis, Valine, leucine and isoleucine biosynthesis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.