ACAD8 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ACAD8 antibody is: synthetic peptide directed towards the N-terminal region of Human ACAD8. Synthetic peptide located within the following region: KFASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGAGESDIYVV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	acyl-CoA dehydrogenase family member 8
Database Link	NP_055199 Entrez Gene 27034 Human UniProt ID Q9UKU7
Background	The function of this protein remains unknown.
Synonyms	ACAD-8; ARC42
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families	Transcription Factors
Protein Pathways	Metabolic pathways, Valine, leucine and isoleucine degradation

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.