Tropomodulin 2 (TMOD2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TMOD2 antibody: synthetic peptide directed towards the N terminal of human TMOD2. Synthetic peptide located within the following region: LDDLDPESAMLPAGFRQKDQTQKAATGPFDREHLLMYLEKEALEQKDRED
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	tropomodulin 2
Database Link	NP_055363 Entrez Gene 29767 Human UniProt ID Q9NZR1
Background	TMOD2 is a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. It caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin.
Synonyms	N-TMOD; NTMOD
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.