Chymotrypsin (CTRC) Rabbit Polyclonal Antibody

CAT#: TA334675

Rabbit Polyclonal Anti-CTRC Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (2)
Transient overexpression lysate of chymotrypsin C (caldecrin) (CTRC)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CTRC antibody: synthetic peptide directed towards the N terminal of human CTRC. Synthetic peptide located within the following region: LGITVLAALLACASSCGVPSFPPNLSARVVGGEDARPHSWPWQISLQYLK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 27 kDa
Gene Name chymotrypsin C
Background CTRC is a member of the peptidase S1 family. The protein is a serum calcium-decreasing factor that has chymotrypsin-like protease activity. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined. This gene encodes a member of the peptidase S1 family. The encoded protein is a serum calcium-decreasing factor that has chymotrypsin-like protease activity. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined.
Synonyms CLCR; ELA4
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rabbit: 93%; Dog: 86%; Rat: 86%; Mouse: 86%; Bovine: 79%
Reference Data
Protein Families Druggable Genome, Protease
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...