PARP12 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PARP12 antibody: synthetic peptide directed towards the middle region of human PARP12. Synthetic peptide located within the following region: FYDSCVNSVSDPSIFVIFEKHQVYPEYVIQYTTSSKPSVTPSILLALGSL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	79 kDa
Gene Name	poly(ADP-ribose) polymerase family member 12
Database Link	NP_073587 Entrez Gene 64761 Human UniProt ID Q9H0J9
Background	The specific function of this protein remains unknown.
Synonyms	ARTD12; MST109; MSTP109; ZC3H1; ZC3HDC1
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Horse: 93%; Rat: 86%; Mouse: 86%; Bovine: 85%; Rabbit: 83%; Dog: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.