ZNF179 (RNF112) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF179 antibody: synthetic peptide directed towards the C terminal of human ZNF179. Synthetic peptide located within the following region: GVALLCKGRDQTLEALEAELQATAKAFMDSYTMRFCGHLAAVGGAVGAGL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	68 kDa
Gene Name	ring finger protein 112
Database Link	NP_009079 Entrez Gene 7732 Human UniProt ID Q9ULX5
Background	ZNF179 encodes a member of the RING finger protein family of transcription factors. The protein is primarily expressed in brain. The gene is located within the Smith-Magenis syndrome region on chromosome 17.
Synonyms	BFP; ZNF179
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Dog: 92%; Pig: 92%; Bovine: 92%; Guinea pig: 92%; Rat: 86%; Mouse: 86%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.