Membralin (TMEM259) Rabbit Polyclonal Antibody
CAT#: TA334763
Rabbit Polyclonal Anti-C19ORF6 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 4,840.00
CNY 3,080.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-C19ORF6 antibody: synthetic peptide directed towards the middle region of human C19ORF6. Synthetic peptide located within the following region: YDDILMSSVKGLAENEENKGFLRNVVSGEHYRFVSMWMARTSYLAAFAIM |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 46 kDa |
Gene Name | transmembrane protein 259 |
Database Link | |
Background | Human membralin is unique and does not share significant sequence homology with other human genes, only membralins of other species. The membralin gene contains 11 exons which encode at least two spliced variants in human cancer. The long form of membralin (membralin-1) comprises all 11 exons, encoding a protein of 620-amino acids long and the short form of membralin (membralin-3) contains all exons except for exon 10, encoding a protein of 408 amino acids. Expression of different membralin isoforms depends on tissue type. The long form, membralin-1, is expressed in ovarian and colorectal carcinomas but not in breast or pancreatic carcinomas, which express only the short splice form, membralin-3. Recent studies suggest that membralin is a novel tumor-associated marker in ovarian serous carcinomas |
Synonyms | ASBABP1; C19orf6; MBRL; MEMBRALIN; R32184_3 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
其它Membralin产品