TAS2R45 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TAS2R45 antibody is: synthetic peptide directed towards the C-terminal region of Human TAS2R45. Synthetic peptide located within the following region: MLANLVPFTVTLISFLLLVCSLCKHLKKMQLHGKGSQDPSTKVHIKVLQT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	taste 2 receptor member 45
Database Link	NP_795367 Entrez Gene 259291 Human
Background	TAS2R45 is a receptor that may play a role in the perception of bitterness and is gustducin-linked. It may play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5
Synonyms	GPR59; T2R45; ZG24P
Note	Immunogen Sequence Homology: Human: 100%; Horse: 86%; Bovine: 86%; Pig: 83%; Guinea pig: 83%
Reference Data
Protein Pathways	Taste transduction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.