C12orf74 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C12orf74 antibody is: synthetic peptide directed towards the N-terminal region of Human C12orf74. Synthetic peptide located within the following region: SPTLRRLRTRGCGTRQDAWQVTTWGSWGAPVGFPCYLSKSLPGSPKDSSH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	19 kDa
Gene Name	chromosome 12 open reading frame 74
Database Link	NP_001171568 Entrez Gene 338809 Human UniProt ID Q32Q52
Background	The function of this protein remains unknown.
Synonyms	MGC125584
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Rabbit: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.