C1orf187 (DRAXIN) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-DRAXIN antibody is: synthetic peptide directed towards the C-terminal region of Human DRAXIN. Synthetic peptide located within the following region: TLDMALFDWTDYEDLKPDGWPSAKKKEKHRGKLSSDGNETSPAEGEPCDH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	dorsal inhibitory axon guidance protein
Database Link	NP_940947 Entrez Gene 374946 Human UniProt ID Q8NBI3
Background	DRAXIN is a chemorepulsive axon guidance protein required for the development of spinal cord and forebrain commissures. It acts as a chemorepulsive guidance protein for commissural axons during development and is able to inhibit or repel neurite outgrowth from dorsal spinal cord. DRAXIN inhibits the stabilization of cytosolic beta-catenin (CTNNB1) via its interaction with LRP6, thereby acting as an antagonist of Wnt signaling pathway.
Synonyms	AGPA3119; C1orf187; neucrin; UNQ3119
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Dog: 93%; Pig: 86%; Bovine: 86%
Reference Data
Protein Families	Secreted Protein, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.