HIP55 (DBNL) Rabbit Polyclonal Antibody

CAT#: TA334945

Rabbit Polyclonal Anti-DBNL Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human drebrin-like (DBNL), transcript variant 1, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Transient overexpression lysate of drebrin-like (DBNL), transcript variant 1
    • 100 ug

CNY 3,080.00


Recombinant protein of human drebrin-like (DBNL), transcript variant 2, 100 µg
    • 100 ug

CNY 9,998.00


Transient overexpression lysate of drebrin-like (DBNL), transcript variant 2
    • 100 ug

CNY 4,840.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-DBNL antibody: synthetic peptide directed towards the middle region of human DBNL. Synthetic peptide located within the following region: QESAVHPREIFKQKERAMSTTSISSPQPGKLRSPFLQKQLTQPETHFGRE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 48 kDa
Gene Name drebrin like
Background DBNL is an actin-binding adapter protein. DBNL may act as a common effector of antigen receptor-signaling pathways in leukocytes. Its association with dynamin suggests that it may also connect the actin cytoskeleton to endocytic function. DBNL acts as a key component of the immunological synapse that regulates T-cell activation by bridging TCRs and the actin cytoskeleton to gene activation and endocytic processes. Binds to F-actin but is not involved in actin.
Synonyms ABP1; HIP-55; HIP55; SH3P7
Note Immunogen Sequence Homology: Dog: 100%; Human: 100%; Mouse: 86%; Pig: 79%; Guinea pig: 79%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...