FRK Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FRK antibody: synthetic peptide directed towards the N terminal of human FRK. Synthetic peptide located within the following region: LCSPQSQRHGHYFVALFDYQARTAEDLSFRAGDKLQVLDTLHEGWWFARH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	58 kDa
Gene Name	fyn related Src family tyrosine kinase
Database Link	NP_002022 Entrez Gene 2444 Human UniProt ID P42685
Background	The specific function of FRK is not yet known.The protein encoded by this gene belongs to the TYR family of protein kinases. This tyrosine kinase is a nuclear protein and may function during G1 and S phase of the cell cycle and suppress growth.
Synonyms	GTK; PTK5; RAK
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Rat: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 92%; Horse: 85%
Reference Data
Protein Families	Druggable Genome, Protein Kinase

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.